PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN07049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 290aa    MW: 32572.7 Da    PI: 5.8403
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN07049.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.25.8e-082342672154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  KHN07049.1 234 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 267
                 469*****************************87 PP

2ELK29.91.2e-10188209122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+ +++++++E++
  KHN07049.1 188 ELKHELKQGYKDKIVDIREEIL 209
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.2E-192569IPR005540KNOX1
PfamPF037907.2E-182767IPR005540KNOX1
SMARTSM012563.5E-2776131IPR005541KNOX2
PfamPF037911.4E-2080130IPR005541KNOX2
SMARTSM011885.1E-4188209IPR005539ELK domain
PROSITE profilePS512139.969188208IPR005539ELK domain
PfamPF037898.9E-6188209IPR005539ELK domain
PROSITE profilePS5007111.726208271IPR001356Homeobox domain
SMARTSM003894.6E-11210275IPR001356Homeobox domain
SuperFamilySSF466892.48E-16210273IPR009057Homeodomain-like
CDDcd000862.74E-12211272No hitNo description
Gene3DG3DSA:1.10.10.602.4E-25215271IPR009057Homeodomain-like
PfamPF059207.0E-18228267IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
GAGAESGDLK GETAPVDGLL NWQNARLKAE ILTHPLYEQL LSAHVACLRI ATPVDQLPRI  60
DAQLAQNVVA KYSAFGQAIV GDDKELDQFL SHYVLLLCSF KEQLQQHVRV HAMEAVMACW  120
EIEQSLQSLT GVSPGEGTGA TMSDDEDEQV DSDANLFDGA LDGPDSMGFG PLIPTENERS  180
LMERVRHELK HELKQGYKDK IVDIREEILR KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE  240
EDKARLVQET GLQLKQINNW FINQRKRNWH SSPSTSTVLK SKRKSADQYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A9e-13211275872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280600.0EF128060.1 Medicago truncatula class II KNOX homeobox transcription factor (KNOX5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581339.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0B2PH690.0A0A0B2PH69_GLYSO; Homeobox protein knotted-1-like 3 (Fragment)
STRINGGLYMA06G06886.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]